DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk3a

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001152755.1 Gene:dkk3a / 570418 ZFINID:ZDB-GENE-110519-1 Length:293 Species:Danio rerio


Alignment Length:138 Identity:27/138 - (19%)
Similarity:51/138 - (36%) Gaps:34/138 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QQTEVYGIVEPLIEDTPCADRPCLLNDDCCPSGVCVSTYGEGKCVYVFGRQRDL-CQGHADCPQG 153
            ::|.....::|..::. ..|..|::::||.....|:......||:..  :|.|. |....:|..|
Zfish   114 EETNNLSSIQPRDKEN-IVDHECVIDEDCEKGKYCLYETHSSKCLPC--KQLDASCTKDEECCAG 175

  Fly   154 SSCMLVPQEGAW-RCEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQQRLHH 217
            ..|:       | :|..::..|.:                |:.|...:||:  ...||    ..|
Zfish   176 QLCV-------WGQCTINITKGDA----------------GTICQYQTDCK--EDFCC----AFH 211

  Fly   218 RAAIKLSC 225
            :|.:...|
Zfish   212 KALLFPVC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk3aNP_001152755.1 Dickkopf_N 135..184 CDD:282549 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.