DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk1

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001016283.1 Gene:dkk1 / 549037 XenbaseID:XB-GENE-481644 Length:257 Species:Xenopus tropicalis


Alignment Length:185 Identity:41/185 - (22%)
Similarity:58/185 - (31%) Gaps:60/185 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CLLNDDCCPSGVCVSTYGEGKCVYVFGR-QRDLCQGHADCPQGSSC---MLVP--------QEGA 164
            |..:|||.....|.|:......|.:..| :|..|...|.|..|:.|   :.||        |:..
 Frog    74 CTEDDDCALDEFCHSSRNGNSLVCLACRKRRKRCLRDAMCCTGNYCSNGICVPVEQDQERFQQQG 138

  Fly   165 WRCEPSVESGGS-----------TSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQ------ 212
            :..|..:|:..:           |:...|:...|.|.  |..|..|:||  ..|:||.:      
 Frog   139 YLEETILENYNADHATMDTHSKLTTSPSGMQPFKGRD--GDVCLRSTDC--APGLCCARHFWSKI 199

  Fly   213 -------------------------QRLHHRAAIKLSCGYFRDAFDCVDMVGAEH 242
                                     ||.|..|.  |||...:..|..|......|
 Frog   200 CKPVLEEGQVCTKHRRKGSHGLEIFQRCHCGAG--LSCRLQKGEFTTVPKTSRLH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk1NP_001016283.1 Dickkopf_N 74..125 CDD:368068 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.