DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and Dkk4

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:169 Identity:36/169 - (21%)
Similarity:59/169 - (34%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGLDEYLGPYGAVEQEQHQPHPPPQQMRQQTEVYGIVEPLIEDTPCADRPCLLNDDCCPSGVCVS 126
            |||..:..|.||:..:.:       .::..::|.|..:         ...|:.:.||.....|.:
  Rat     7 LGLSWFCSPLGALVLDFN-------NIKSSSDVQGSGK---------GSQCVSDKDCNVGKFCFA 55

  Fly   127 TYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVE---SGGSTSLLEGI--FGA 186
            .:.|........|.|..||..|.|..|:.|:...........|.::   .|...:..||.  :.|
  Rat    56 LHDERSFCATCRRVRRRCQRSAMCCPGTVCVNDVCTAVENTRPVMDRNTDGQDGTYAEGTTKWPA 120

  Fly   187 KERQPL---------------GSECSSSSDCQVINGMCC 210
            :|.:|.               |..|..:|||.  .|:||
  Rat   121 EENRPQGKPSTKKSQSNKGQEGESCLRTSDCG--PGLCC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
Dkk4NP_001102802.1 Dickkopf_N 41..91 CDD:282549 13/49 (27%)
Prokineticin <145..202 CDD:148298 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.