Sequence 1: | NP_610434.1 | Gene: | spab / 35901 | FlyBaseID: | FBgn0033358 | Length: | 245 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055236.1 | Gene: | DKK2 / 27123 | HGNCID: | 2892 | Length: | 259 | Species: | Homo sapiens |
Alignment Length: | 259 | Identity: | 52/259 - (20%) |
---|---|---|---|
Similarity: | 75/259 - (28%) | Gaps: | 109/259 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 PSLAASASSFASGNAWQRALFG--RESRNLMHRRAPFSGAADLGLDEYLGPYGAVEQEQHQPHPP 84
Fly 85 PQQMRQQTEVYGIVEPLIEDTPC-----ADRPCLLNDDCCPSGVCVSTYGEGKCVYVF------- 137
Fly 138 ------GRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSEC 196
Fly 197 SSSSDCQVINGMCC---------------------QQQRLHHRAAI--------KLSCGYFRDA 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
spab | NP_610434.1 | None | |||
DKK2 | NP_055236.1 | Dickkopf_N | 78..128 | CDD:282549 | 13/82 (16%) |
DKK-type Cys-1 | 78..127 | 13/81 (16%) | |||
DKK-type Cys-2 | 183..256 | 17/65 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1139517at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |