DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and DKK2

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_055236.1 Gene:DKK2 / 27123 HGNCID:2892 Length:259 Species:Homo sapiens


Alignment Length:259 Identity:52/259 - (20%)
Similarity:75/259 - (28%) Gaps:109/259 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSLAASASSFASGNAWQRALFG--RESRNLMHRRAPFSGAADLGLDEYLGPYGAVEQEQHQPHPP 84
            |..||:.|:    ..:|...||  ::.:|| .:..|.|...:..:..|.          |.||. 
Human    47 PGQAANRSA----GMYQGLAFGGSKKGKNL-GQAYPCSSDKECEVGRYC----------HSPHQ- 95

  Fly    85 PQQMRQQTEVYGIVEPLIEDTPC-----ADRPCLLNDDCCPSGVCVSTYGEGKCVYVF------- 137
                              ..:.|     ..:.|..:..||||..|    ..|.|:.|.       
Human    96 ------------------GSSACMVCRRKKKRCHRDGMCCPSTRC----NNGICIPVTESILTPH 138

  Fly   138 ------GRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSEC 196
                  .|.||...||..          ..:..|:     ..|...:.:..|.|.:     |..|
Human   139 IPALDGTRHRDRNHGHYS----------NHDLGWQ-----NLGRPHTKMSHIKGHE-----GDPC 183

  Fly   197 SSSSDCQVINGMCC---------------------QQQRLHHRAAI--------KLSCGYFRDA 231
            ..||||  |.|.||                     |:::..|...|        .|||..::||
Human   184 LRSSDC--IEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
DKK2NP_055236.1 Dickkopf_N 78..128 CDD:282549 13/82 (16%)
DKK-type Cys-1 78..127 13/81 (16%)
DKK-type Cys-2 183..256 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.