DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and DKK4

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_055235.1 Gene:DKK4 / 27121 HGNCID:2894 Length:224 Species:Homo sapiens


Alignment Length:179 Identity:41/179 - (22%)
Similarity:62/179 - (34%) Gaps:58/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGLDEYLGPYGAVEQEQHQPHPPPQQMRQQTEVYGIVE--PLIEDTPCADRP-CLLNDD------ 117
            |||.....|.||:..:.:       .:|...:::|..:  ..:.||.|..|. ||...|      
Human     7 LGLSWLCSPLGALVLDFN-------NIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCA 64

  Fly   118 --------------CCPSGVCVSTYGEGKCVY------VFGRQRDLCQG-HADCPQGSSCMLVPQ 161
                          |||..:||:..    |..      :..||.|...| ||:...|...    |
Human    65 TCRGLRRRCQRDAMCCPGTLCVNDV----CTTMEDATPILERQLDEQDGTHAEGTTGHPV----Q 121

  Fly   162 EGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
            |...:.:||::...         |.|.::  |..|..:.||.  .|:||
Human   122 ENQPKRKPSIKKSQ---------GRKGQE--GESCLRTFDCG--PGLCC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
DKK4NP_055235.1 Dickkopf_N 41..91 CDD:309719 12/53 (23%)
DKK-type Cys-1 41..90 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..139 9/42 (21%)
DKK-type Cys-2 145..218 6/15 (40%)
Prokineticin <145..202 CDD:148298 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.