DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkkx

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002940985.2 Gene:dkkx / 100491236 XenbaseID:XB-GENE-1219019 Length:187 Species:Xenopus tropicalis


Alignment Length:108 Identity:26/108 - (24%)
Similarity:36/108 - (33%) Gaps:40/108 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGA 186
            |:||:...||:          .|:..:.|.:|..||.      .||:..:..|..          
 Frog    67 GLCVALRHEGQ----------YCRKDSQCVRGLGCMY------GRCQRMIPGGHE---------- 105

  Fly   187 KERQPLGSECSSSSDCQVINGMCCQQQRLHHRAAI---KLSCG 226
                  |:.|....||.  ..|||.:   ||...|   ||..|
 Frog   106 ------GARCRQDKDCS--PNMCCAR---HHGEMICKRKLPLG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkkxXP_002940985.2 Dickkopf_N 50..97 CDD:368068 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.