DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babo and BMPR2

DIOPT Version :10

Sequence 1:NP_476999.1 Gene:babo / 35900 FlyBaseID:FBgn0011300 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001195.2 Gene:BMPR2 / 659 HGNCID:1078 Length:1038 Species:Homo sapiens


Alignment Length:42 Identity:13/42 - (30%)
Similarity:19/42 - (45%) Gaps:7/42 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LKNLDLSYNQIQQLLPVTGRPARMLSIETLTLRGNLLQNLDL 173
            |:|....||::..|...|....|:..|:.       :|||||
Human    53 LQNQTHEYNEVASLFGKTMDRNRIKRIQR-------IQNLDL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baboNP_476999.1 TFP_LU_ECD_Babo 127..210 CDD:467127 13/42 (31%)
GS 294..324 CDD:197743
STKc_TGFbR1_ACVR1b_ACVR1c 328..615 CDD:271045
BMPR2NP_001195.2 TFP_LU_ECD_BMPR2 32..131 CDD:467134 13/42 (31%)
STKc_BMPR2_AMHR2 207..504 CDD:270956
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 593..626
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 872..972
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.