DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babo and pomk

DIOPT Version :9

Sequence 1:NP_476999.1 Gene:babo / 35900 FlyBaseID:FBgn0011300 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001007415.1 Gene:pomk / 492773 ZFINID:ZDB-GENE-041114-119 Length:347 Species:Danio rerio


Alignment Length:251 Identity:66/251 - (26%)
Similarity:105/251 - (41%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 RSIARQVQLCHVIGKGRFGEVWRGRWRGENVAVKIFSSREECSWFREAEIYQTVMLR---HENIL 379
            ||..|:|:|   ||:|...:|:...|:|:.||:.:.||.:....|    ::...|||   ..:::
Zfish    76 RSGVRRVKL---IGQGAVKKVYLSEWQGQKVALSVLSSDQYADDF----LHGLSMLRALQSSHVV 133

  Fly   380 GFIAADNKDNGTWTQLWLVTDYHENGSLFDYLTTHPVDT-------NTMLNMSLSIATGLAHLHM 437
            ..:....:|      ...||:||..||:....||...:.       :|.|.:::.....||:||.
Zfish   134 TLVGVCEED------AVFVTEYHPLGSVLTLDTTLAQERYRWRNSWHTRLQLAIDYVAFLAYLHS 192

  Fly   438 DIVGTRGKPAIAHRDLKS--KNILVKSNLSCAIGDLGLAVRHVEKNDSVDIPSTHRVGTKRYMAP 500
            ...|.|  ......||..  ...|:.|::.....||. |:..|||. .:.:...|...|..::||
Zfish   193 SPAGIR--VMCDSNDLHKTLSQFLLASDMRLLANDLD-ALPEVEKG-GLGVKCGHHELTGDFVAP 253

  Fly   501 EVL----------DESM--NDQHFDSYKRADVYAF--GLILWEIARRCNMGMIYDE 542
            |.|          ||:|  .|:..|.:|..||..|  |.:|.......::..||.|
Zfish   254 EQLWPYGEDFSFSDEAMPGYDEKTDIWKIPDVTRFLLGDVLGGDVIHFHLFQIYSE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baboNP_476999.1 Activin_recp 127..214 CDD:279413
GS 294..324 CDD:197743 3/5 (60%)
Pkinase_Tyr 324..611 CDD:285015 63/245 (26%)
STKc_TGFbR1_ACVR1b_ACVR1c 328..615 CDD:271045 61/241 (25%)
pomkNP_001007415.1 Pkinase 81..326 CDD:278497 63/246 (26%)
PKc_like 85..>194 CDD:304357 29/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.