DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom7 and TOM7

DIOPT Version :10

Sequence 1:NP_610433.1 Gene:Tom7 / 35899 FlyBaseID:FBgn0033357 Length:54 Species:Drosophila melanogaster
Sequence 2:NP_014329.1 Gene:TOM7 / 855654 SGDID:S000005014 Length:60 Species:Saccharomyces cerevisiae


Alignment Length:52 Identity:19/52 - (36%)
Similarity:29/52 - (55%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPP--LNLFSLL 52
            ||:..|:|:..::.:.....|:|::|.|||||:   |.....|  |||.|.|
Yeast     9 LSDESKERISKILTLTHNVAHYGWIPFVLYLGW---AHTSNRPNFLNLLSPL 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom7NP_610433.1 Tom7 8..52 CDD:462344 16/45 (36%)
TOM7NP_014329.1 Tom7 14..54 CDD:462344 14/42 (33%)

Return to query results.
Submit another query.