DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom7 and Tomm7

DIOPT Version :10

Sequence 1:NP_610433.1 Gene:Tom7 / 35899 FlyBaseID:FBgn0033357 Length:54 Species:Drosophila melanogaster
Sequence 2:NP_001128646.1 Gene:Tomm7 / 685620 RGDID:1591393 Length:55 Species:Rattus norvegicus


Alignment Length:53 Identity:27/53 - (50%)
Similarity:36/53 - (67%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFSLLW 53
            :|||:..|.||..:....|....|||:|||:||||.:||:||||..::.||||
  Rat     2 VKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVLSLLW 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom7NP_610433.1 Tom7 8..52 CDD:462344 21/43 (49%)
Tomm7NP_001128646.1 Tom7 9..53 CDD:462344 21/43 (49%)

Return to query results.
Submit another query.