DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and spint1b

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001104693.1 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:499 Species:Danio rerio


Alignment Length:96 Identity:36/96 - (37%)
Similarity:43/96 - (44%) Gaps:13/96 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FPMDLYDDVSDFFDA-------ISLDDVAN--TGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQ 82
            |..|.:.:.||..|.       .||..:.|  ..:..|    |..|...|.|||....|.|||..
Zfish   325 FECDGHQECSDGSDEKNCQQLNESLTRLLNIEVNKKAH----CTDPPATGPCRAHFHHWYYDPLS 385

  Fly    83 KKCVEFKFGGCDGNENNFASYKDCMSTCEGM 113
            |||..|.:||||||.|||.:...||..|.|:
Zfish   386 KKCHSFTYGGCDGNRNNFETADKCMKNCSGV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 25/50 (50%)
spint1bNP_001104693.1 MANEC 31..116 CDD:284837
PKD 148..225 CDD:214510
Kunitz_BPTI 235..285 CDD:278443
LDLa 308..342 CDD:238060 5/16 (31%)
Kunitz_BPTI 363..413 CDD:278443 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.