DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and aplp2

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_005159308.1 Gene:aplp2 / 796801 ZFINID:ZDB-GENE-061009-28 Length:776 Species:Danio rerio


Alignment Length:55 Identity:28/55 - (50%)
Similarity:36/55 - (65%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            |..|.:.|..|.|||.:|||.:|.:|:|||.|.:|||.||.|||.|.:.||..|:
Zfish   312 EAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 26/50 (52%)
aplp2XP_005159308.1 A4_EXTRA 31..195 CDD:128326
APP_N 38..138 CDD:280358
APP_Cu_bd 140..195 CDD:289676
Kunitz_BPTI 314..366 CDD:278443 26/51 (51%)
APP_E2 371..553 CDD:289677
APP_amyloid 722..772 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9689
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2378
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.