powered by:
Protein Alignment CG13748 and aplp2
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005159308.1 |
Gene: | aplp2 / 796801 |
ZFINID: | ZDB-GENE-061009-28 |
Length: | 776 |
Species: | Danio rerio |
Alignment Length: | 55 |
Identity: | 28/55 - (50%) |
Similarity: | 36/55 - (65%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
|..|.:.|..|.|||.:|||.:|.:|:|||.|.:|||.||.|||.|.:.||..|:
Zfish 312 EAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCK 366
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
68 |
1.000 |
Domainoid score |
I9689 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2378 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.840 |
|
Return to query results.
Submit another query.