DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Eppin

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:67 Identity:27/67 - (40%)
Similarity:35/67 - (52%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VANTGRN-THPEQ-FCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMST 109
            |.|.|:. .:|:| .|.:|...|.|.|...||.::.|...|..|.:|||.||.|||.|...|.:.
Mouse    62 VFNCGKKCLNPQQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNA 126

  Fly   110 CE 111
            ||
Mouse   127 CE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 23/56 (41%)
EppinNP_083601.1 WAP 30..72 CDD:459672 3/9 (33%)
Kunitz_eppin 75..131 CDD:438654 22/54 (41%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 14/27 (52%)
Interaction with LTF. /evidence=ECO:0000250 117..133 5/12 (42%)

Return to query results.
Submit another query.