DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13748 and Wfdc6a

DIOPT Version :9

Sequence 1:	NP_610430.1	Gene:	CG13748 / 35896	FlyBaseID:	FBgn0033355	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_001233212.2	Gene:	Wfdc6a / 685153	RGDID:	1597730	Length:	146	Species:	Rattus norvegicus

Alignment Length:	55	Identity:	23/55 - (41%)
Similarity:	30/55 - (54%)	Gaps:	0/55 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            |..|.:|...|.|.|.:|||.|:.:...|.:|.:|||.||.|||.|...|...|:
  Rat    84 EDICSLPQDAGPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVCK 138

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13748	NP_610430.1	Kunitz_BPTI	59..110	CDD:278443	21/50 (42%)
Wfdc6a	NP_001233212.2	WAP	42..81	CDD:278522
Wfdc6a	NP_001233212.2	Kunitz_BPTI	86..138	CDD:278443	21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.810