DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Spint3

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:62 Identity:27/62 - (43%)
Similarity:36/62 - (58%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |..|.:.| ..|::|...|.|||:..||.|:.:..||..|::|||.||||||.|...|.:.|
Mouse    25 NVPRKSLP-PMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 23/50 (46%)
Spint3NP_001170872.1 Kunitz_BPTI 35..85 CDD:278443 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.