DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and appa

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_571639.1 Gene:appa / 58083 ZFINID:ZDB-GENE-000616-13 Length:738 Species:Danio rerio


Alignment Length:56 Identity:25/56 - (44%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCEGM 113
            :.|...|..|.|||::.||.|..|:::|..|.:|||.||.|||.|.:.|:|.|.|:
Zfish   291 EVCFASAETGPCRAMLSRWYYVREERRCAPFIYGGCGGNRNNFESEEYCLSVCSGV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 24/53 (45%)
appaNP_571639.1 A4_EXTRA 28..189 CDD:128326
Kunitz_ABPP-like 293..343 CDD:438650 23/49 (47%)
APP_E2 349..531 CDD:463752
JMTM_Notch_APP 661..735 CDD:425406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.