DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and tfpi2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:60 Identity:23/60 - (38%)
Similarity:35/60 - (58%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |....|::.||:...:|.|...|.|:.|:...::|.||.:.||.||:|||.|:.:|..||
Zfish    21 GLTLQPKEVCLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRSFVECQKTC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 21/54 (39%)
tfpi2NP_001035185.1 Kunitz-type 30..80 CDD:438633 19/49 (39%)
Kunitz_TFPI2_2-like 87..140 CDD:438660
Kunitz_TFPI1_TFPI2_3-like 147..200 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.