powered by:
Protein Alignment CG13748 and si:dkey-117n7.5
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038359.1 |
Gene: | si:dkey-117n7.5 / 559444 |
ZFINID: | ZDB-GENE-060503-331 |
Length: | 172 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 24/70 - (34%) |
Similarity: | 35/70 - (50%) |
Gaps: | 9/70 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 AISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
::::|..| :.||.|..:|.|...:..|.|.....:|..|.:|||.||.|.|:|.:|
Zfish 103 SVNVDSAA---------ELCLEPMSEGHCTEYVLLWYYYAVSGECRPFVYGGCGGNGNRFSSKQD 158
Fly 106 CMSTC 110
|.|||
Zfish 159 CQSTC 163
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.