DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and col28a1a

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:61 Identity:23/61 - (37%)
Similarity:28/61 - (45%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HPEQF-----CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            ||:..     |......|.||.....|.|||:...|.:|.:|||.||.|.|.:...|.|||
Zfish  1107 HPDNSLKHVGCGQGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 19/55 (35%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
Collagen 266..339 CDD:189968
Collagen 311..384 CDD:189968
Collagen 491..548 CDD:189968
Collagen 529..590 CDD:189968
Collagen 561..633 CDD:189968
Collagen 700..776 CDD:189968
VWA 803..980 CDD:306576
Kunitz_BPTI 1117..1168 CDD:278443 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.