| Sequence 1: | NP_610430.1 | Gene: | CG13748 / 35896 | FlyBaseID: | FBgn0033355 | Length: | 113 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001015766.1 | Gene: | tfpi2 / 548483 | XenbaseID: | XB-GENE-1002090 | Length: | 219 | Species: | Xenopus tropicalis |
| Alignment Length: | 51 | Identity: | 26/51 - (50%) |
|---|---|---|---|
| Similarity: | 33/51 - (64%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13748 | NP_610430.1 | Kunitz-type | 57..112 | CDD:444694 | 26/51 (51%) |
| tfpi2 | NP_001015766.1 | Kunitz_TFPI2_1-like | 25..81 | CDD:438659 | 26/51 (51%) |
| Kunitz_TFPI2_2-like | 86..139 | CDD:438660 | |||
| Kunitz_TFPI1_TFPI2_3-like | 146..199 | CDD:438658 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||