DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and tfpi2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001015766.1 Gene:tfpi2 / 548483 XenbaseID:XB-GENE-1002090 Length:219 Species:Xenopus tropicalis


Alignment Length:51 Identity:26/51 - (50%)
Similarity:33/51 - (64%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            ||:|..:|.|:||||.:.||...:.|.||.:||||||.|.|.|.:||...|
 Frog    29 CLLPPDEGPCKALIPHYYYDRYTQTCQEFLYGGCDGNSNKFLSMEDCEKFC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 26/51 (51%)
tfpi2NP_001015766.1 Kunitz_TFPI2_1-like 25..81 CDD:438659 26/51 (51%)
Kunitz_TFPI2_2-like 86..139 CDD:438660
Kunitz_TFPI1_TFPI2_3-like 146..199 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.