DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and App

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_062161.1 Gene:App / 54226 RGDID:2139 Length:770 Species:Rattus norvegicus


Alignment Length:53 Identity:24/53 - (45%)
Similarity:32/53 - (60%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            :.|...|..|.|||:|.||.:|..:.||..|.:|||.||.|||.:.:.||:.|
  Rat   289 EVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 23/50 (46%)
AppNP_062161.1 A4_EXTRA 24..188 CDD:128326
GFLD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 28..123
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P05067 96..110
CuBD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 131..189
Copper-binding. /evidence=ECO:0000250 135..155
Zinc-binding. /evidence=ECO:0000250 181..188
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..283
Kunitz_BPTI 294..341 CDD:333766 22/46 (48%)
OX-2. /evidence=ECO:0000250|UniProtKB:P05067 344..365
APP_E2 366..548 CDD:372388
Heparin-binding. /evidence=ECO:0000250 391..423
Heparin-binding. /evidence=ECO:0000250 491..522
Collagen-binding. /evidence=ECO:0000250|UniProtKB:P05067 523..540
Beta-APP 677..713 CDD:367525
Interaction with PSEN1. /evidence=ECO:0000250|UniProtKB:P05067 695..722
APP_amyloid 716..766 CDD:371108
Basolateral sorting signal. /evidence=ECO:0000250 724..734
Interaction with G(o)-alpha 732..751
Required for the interaction with KIF5B and for anterograde transport in axons. /evidence=ECO:0000250|UniProtKB:P05067 756..770
YENPXY motif, contains endocytosis signal. /evidence=ECO:0000250|UniProtKB:P05067 757..762
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.