DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and app

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001005698.1 Gene:app / 448208 XenbaseID:XB-GENE-479154 Length:750 Species:Xenopus tropicalis


Alignment Length:96 Identity:33/96 - (34%)
Similarity:50/96 - (52%) Gaps:17/96 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SEAFPMDLYDDVSDFFDAI---------SLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYD 79
            :|..|.:.|::.::...:|         |:::|.        .:.|...|..|.|||:||||.||
 Frog   252 AEEEPEEPYEEATERTTSIATTTTTTTESVEEVV--------REVCSEQAETGPCRAMIPRWYYD 308

  Fly    80 PEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            ..::||.:|.:|||.||.|||.|...||:.|
 Frog   309 VTERKCAQFIYGGCGGNRNNFDSEDYCMAVC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 27/54 (50%)
appNP_001005698.1 A4_EXTRA 23..187 CDD:128326
Kunitz_ABPP-like 292..339 CDD:438650 25/46 (54%)
APP_E2 347..528 CDD:463752
JMTM_Notch_APP 673..747 CDD:425406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.