DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13748 and Wfdc6b

DIOPT Version :9

Sequence 1:	NP_610430.1	Gene:	CG13748 / 35896	FlyBaseID:	FBgn0033355	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	XP_006499938.1	Gene:	Wfdc6b / 433502	MGIID:	3575430	Length:	155	Species:	Mus musculus

Alignment Length:	54	Identity:	26/54 - (48%)
Similarity:	32/54 - (59%)	Gaps:	0/54 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |..|.:|...|.|.|.:|||.|:.:.|.|:||.:|||.||.|||.|...|.|.|
Mouse    92 EDICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13748	NP_610430.1	Kunitz_BPTI	59..110	CDD:278443	24/50 (48%)
Wfdc6b	XP_006499938.1	WAP	<63..89	CDD:365870
Wfdc6b	XP_006499938.1	Kunitz_BPTI	94..145	CDD:333766	24/50 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.810