powered by:
Protein Alignment CG13748 and Wfdc13
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001012722.1 |
Gene: | Wfdc13 / 408190 |
MGIID: | 3582777 |
Length: | 81 |
Species: | Mus musculus |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 18/51 - (35%) |
Gaps: | 9/51 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 PEQFCLM------PARK--GVCRALIPRWRYDPEQKKCVEFKFG-GCDGNE 97
|:|:.|. |.|. |.|.....:....||..:|.....| .|..|:
Mouse 24 PKQYFLKYILEPPPCRSEPGACNMFCTQQEECPEPLQCCSAYCGIVCTSNQ 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13748 | NP_610430.1 |
Kunitz_BPTI |
59..110 |
CDD:278443 |
11/48 (23%) |
Wfdc13 | NP_001012722.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.