DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and wfikkn1

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_999912.1 Gene:wfikkn1 / 406570 ZFINID:ZDB-GENE-040426-2465 Length:558 Species:Danio rerio


Alignment Length:51 Identity:20/51 - (39%)
Similarity:32/51 - (62%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.:||.:|.||....||.|:...::|..|.:|||.||:|:|.:.::|.:.|
Zfish   371 CSLPAVQGPCRHWQARWFYNSLTERCEAFLYGGCSGNKNSFGTRRECDAHC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/51 (39%)
wfikkn1NP_999912.1 WAP 25..72 CDD:459672
KAZAL_FS 124..160 CDD:238052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..194
Ig 193..287 CDD:472250
Ig strand B 210..214 CDD:409353
Ig strand C 223..227 CDD:409353
Ig strand E 245..249 CDD:409353
Ig strand F 267..272 CDD:409353
Ig strand G 280..283 CDD:409353
Kunitz_WFIKKN_1-like 313..363 CDD:438648
Kunitz_WFIKKN_2-like 370..422 CDD:438649 20/51 (39%)
NTR_WFIKKN 439..547 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.