| Sequence 1: | NP_610430.1 | Gene: | CG13748 / 35896 | FlyBaseID: | FBgn0033355 | Length: | 113 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_999912.1 | Gene: | wfikkn1 / 406570 | ZFINID: | ZDB-GENE-040426-2465 | Length: | 558 | Species: | Danio rerio |
| Alignment Length: | 51 | Identity: | 20/51 - (39%) |
|---|---|---|---|
| Similarity: | 32/51 - (62%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13748 | NP_610430.1 | Kunitz-type | 57..112 | CDD:444694 | 20/51 (39%) |
| wfikkn1 | NP_999912.1 | WAP | 25..72 | CDD:459672 | |
| KAZAL_FS | 124..160 | CDD:238052 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 167..194 | ||||
| Ig | 193..287 | CDD:472250 | |||
| Ig strand B | 210..214 | CDD:409353 | |||
| Ig strand C | 223..227 | CDD:409353 | |||
| Ig strand E | 245..249 | CDD:409353 | |||
| Ig strand F | 267..272 | CDD:409353 | |||
| Ig strand G | 280..283 | CDD:409353 | |||
| Kunitz_WFIKKN_1-like | 313..363 | CDD:438648 | |||
| Kunitz_WFIKKN_2-like | 370..422 | CDD:438649 | 20/51 (39%) | ||
| NTR_WFIKKN | 439..547 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||