DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and ambp

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:57 Identity:23/57 - (40%)
Similarity:30/57 - (52%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCEGM 113
            |..|.:|...|.|:|.:..|.:|....||:..|:|||.||.|.|.|.|:|...|..|
Zfish   278 EAACRLPMDAGPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYCGAM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 22/54 (41%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639
Kunitz_bikunin_2-like 278..332 CDD:438640 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.