powered by:
Protein Alignment CG13748 and Y57E12AR.1
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033516.1 |
Gene: | Y57E12AR.1 / 3896861 |
WormBaseID: | WBGene00044612 |
Length: | 99 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 17/64 - (26%) |
Similarity: | 27/64 - (42%) |
Gaps: | 8/64 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 THPEQFCLMPARKGVC-------RALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
|:| ..|.:|....:| ..|..|:.:|...::|..|....|.||:|.|.:..:|...|
Worm 31 TYP-SICYLPPDSALCDFSANTPDNLSTRYYFDVATQECYPFGVQKCGGNQNQFNNRSECQQFC 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.