DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG10031

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:55 Identity:21/55 - (38%)
Similarity:30/55 - (54%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |:..||.|...|.||..:.|:.|:.:.|.|..||:|||.||:|.:...:.|...|
  Fly    71 PDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/54 (37%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 19/49 (39%)

Return to query results.
Submit another query.