DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG16713

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:42 Identity:20/42 - (47%)
Similarity:26/42 - (61%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.|.||.|.||.::.:||:|.:|||.||.|.|.|.:.|...|
  Fly    39 CEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/42 (48%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/40 (48%)

Return to query results.
Submit another query.