DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Acp24A4

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:54 Identity:24/54 - (44%)
Similarity:33/54 - (61%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QFCLMP-ARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            :.|.:| |..|.|.||..||.||.:...|..|.:|||.||||:|.|.::|::.|
  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 24/54 (44%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 23/50 (46%)

Return to query results.
Submit another query.