DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Spint1

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:78 Identity:30/78 - (38%)
Similarity:43/78 - (55%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DAISLDDVAN------TGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNEN 98
            |:..|::..|      |...|  |.:||...:.|.||...|||.|||:::.|..|.||||.||:|
  Rat   220 DSDQLEETVNLTITVLTAEQT--EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKN 282

  Fly    99 NFASYKDCMSTCE 111
            |:...::||..|:
  Rat   283 NYLREEECMLACK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 25/55 (45%)
Spint1NP_001004265.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666 26/59 (44%)
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.