DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13748 and Tfpi

DIOPT Version :9

Sequence 1:	NP_610430.1	Gene:	CG13748 / 35896	FlyBaseID:	FBgn0033355	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	XP_008760202.1	Gene:	Tfpi / 29436	RGDID:	61914	Length:	306	Species:	Rattus norvegicus

Alignment Length:	53	Identity:	23/53 - (43%)
Similarity:	36/53 - (67%)	Gaps:	0/53 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 FCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            ||.:....|:||..:.|:.|:.:.|:|.:||:|||.||.|||.:.::|.:|||
  Rat   123 FCFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCE 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13748	NP_610430.1	Kunitz_BPTI	59..110	CDD:278443	20/50 (40%)
Tfpi	XP_008760202.1	KU	51..104	CDD:238057
		KU	122..174	CDD:238057	20/50 (40%)
		Kunitz_BPTI	225..276	CDD:278443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10083
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	5	4.910