| Sequence 1: | NP_610430.1 | Gene: | CG13748 / 35896 | FlyBaseID: | FBgn0033355 | Length: | 113 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001385521.1 | Gene: | Wfikkn2 / 287631 | RGDID: | 1305361 | Length: | 571 | Species: | Rattus norvegicus |
| Alignment Length: | 55 | Identity: | 24/55 - (43%) |
|---|---|---|---|
| Similarity: | 34/55 - (61%) | Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 PEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13748 | NP_610430.1 | Kunitz-type | 57..112 | CDD:444694 | 23/54 (43%) |
| Wfikkn2 | NP_001385521.1 | WAP | 37..86 | CDD:459672 | |
| KAZAL_FS | 133..169 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 205..299 | CDD:409422 | |||
| Ig strand A | 205..208 | CDD:409422 | |||
| Ig strand A' | 213..216 | CDD:409422 | |||
| Ig strand B | 221..228 | CDD:409422 | |||
| Ig strand C | 235..240 | CDD:409422 | |||
| Ig strand C' | 241..243 | CDD:409422 | |||
| Ig strand D | 245..250 | CDD:409422 | |||
| Ig strand E | 258..264 | CDD:409422 | |||
| Ig strand F | 278..286 | CDD:409422 | |||
| Ig strand G | 289..299 | CDD:409422 | |||
| Kunitz_WFIKKN_1-like | 322..373 | CDD:438648 | |||
| Kunitz_WFIKKN_2-like | 380..432 | CDD:438649 | 23/52 (44%) | ||
| NTR_WFIKKN | 450..558 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||