DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Tfpi2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_775164.2 Gene:Tfpi2 / 286926 RGDID:628629 Length:230 Species:Rattus norvegicus


Alignment Length:70 Identity:35/70 - (50%)
Similarity:44/70 - (62%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
            |:.|..|:..|.|.   :.||:|...|.|:||||::.||.:||||..||:|||.||.|||.|.|.
  Rat    20 ALGLASVSAQGNNL---EICLLPLDMGPCKALIPKFYYDRDQKKCRRFKYGGCLGNANNFHSRKL 81

  Fly   106 CMSTC 110
            |..||
  Rat    82 CEHTC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 30/54 (56%)
Tfpi2NP_775164.2 Kunitz-type 32..87 CDD:444694 31/58 (53%)
Kunitz-type 93..146 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 153..206 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.