DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13748 and Tfpi2

DIOPT Version :9

Sequence 1:	NP_610430.1	Gene:	CG13748 / 35896	FlyBaseID:	FBgn0033355	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_775164.2	Gene:	Tfpi2 / 286926	RGDID:	628629	Length:	230	Species:	Rattus norvegicus

Alignment Length:	70	Identity:	35/70 - (50%)
Similarity:	44/70 - (62%)	Gaps:	3/70 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 AISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
            |:.|..|:..|.|.   :.||:|...|.|:||||::.||.:||||..||:|||.||.|||.|.|.
  Rat    20 ALGLASVSAQGNNL---EICLLPLDMGPCKALIPKFYYDRDQKKCRRFKYGGCLGNANNFHSRKL 81

  Fly   106 CMSTC 110
            |..||
  Rat    82 CEHTC 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13748	NP_610430.1	Kunitz_BPTI	59..110	CDD:278443	28/50 (56%)
Tfpi2	NP_775164.2	KU	34..87	CDD:238057	30/53 (57%)
Tfpi2	NP_775164.2	Kunitz_BPTI	155..207	CDD:394972
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10083
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	5	4.910