DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and AMBP

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:89 Identity:30/89 - (33%)
Similarity:39/89 - (43%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDDVSDFFDAISLDDVANTGRNTHPEQFCL----------MPARKGVCRALIPRWRYDPEQKKCV 86
            |:..|...:..........|.|...|:.||          :|..:|.|||.|..|.:|..:.|||
Human   249 YNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCV 313

  Fly    87 EFKFGGCDGNENNFASYKDCMSTC 110
            .|.:|||.||.|.|.|.|:|...|
Human   314 LFPYGGCQGNGNKFYSEKECREYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 24/60 (40%)
AMBPNP_001624.1 Lipocalin 22..>48 CDD:328776
Lipocalin 42..186 CDD:306552
Glycopeptide (secretory piece) 206..226
KU 229..282 CDD:238057 7/32 (22%)
Kunitz_BPTI 286..338 CDD:278443 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.