DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Wfdc6a

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:83 Identity:29/83 - (34%)
Similarity:34/83 - (40%) Gaps:24/83 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MDLYDDVSDFFDAISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGC 93
            |||..||                        |.:|...|.|.|.:|||.|:.|...|.||.:|||
Mouse   127 MDLRQDV------------------------CSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGC 167

  Fly    94 DGNENNFASYKDCMSTCE 111
            .||.|||.|...|...|:
Mouse   168 QGNPNNFPSEGICTVVCK 185

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 23/50 (46%)