DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and C10G8.3

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_504417.2 Gene:C10G8.3 / 182502 WormBaseID:WBGene00015682 Length:190 Species:Caenorhabditis elegans


Alignment Length:36 Identity:13/36 - (36%)
Similarity:19/36 - (52%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |:..|...:.|:.|.:.||..|.||||:.:.|...|
 Worm    48 RYYMDVPTETCLAFNYTGCGHNWNNFATSQACYEEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 13/36 (36%)
C10G8.3NP_504417.2 KU 29..83 CDD:197529 12/34 (35%)

Return to query results.
Submit another query.