DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and E01G6.1

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:80 Identity:22/80 - (27%)
Similarity:33/80 - (41%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLDDVANTGRNTHPEQFCLMPARKGVCRALIPR------------WRYDPEQKKCVEFKFGGCDG 95
            |.:|....|...:...:| .|:.:..|.|.:.|            |.||..:|||.:|.:.||.|
 Worm   517 SEEDPCPAGYECNDSSYC-CPSSENACNANMSRGNGCKGSTQRSMWFYDKSKKKCSQFVYNGCGG 580

  Fly    96 NENNFASYKDCMSTC 110
            ..|.|.:...|..:|
 Worm   581 TPNRFTTKVACTESC 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 18/62 (29%)
E01G6.1NP_510044.2 Lustrin_cystein 95..136 CDD:291299
WR1 289..325 CDD:214601
Kunitz_BPTI 330..386 CDD:278443
Kunitz_BPTI 437..492 CDD:278443
Kunitz_BPTI 541..596 CDD:278443 17/55 (31%)
Lustrin_cystein 860..902 CDD:291299
Lustrin_cystein 909..951 CDD:291299
Lustrin_cystein 963..1006 CDD:291299
EB 1265..1321 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.