DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and mec-9

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 / 179382 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans


Alignment Length:84 Identity:24/84 - (28%)
Similarity:40/84 - (47%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PMDLYDDVSDFFDAISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGG 92
            |..|:.....|.:.:...|.....:|.  |..||.....|.|:....:|.:|.:.::|.||.:||
 Worm     6 PHKLFPFFLVFLNLVDTKDEPVFVKNN--EDICLEDVDPGPCQYYQVQWFWDKQVEECKEFHYGG 68

  Fly    93 CDGNENNFASYKDCMSTCE 111
            |.|.:|.|:|.:.|:..|:
 Worm    69 CMGTKNRFSSKQQCVKQCK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 17/50 (34%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:278443 17/51 (33%)
Kunitz_BPTI 100..154 CDD:278443
EGF_CA 199..238 CDD:284955
EGF_3 283..318 CDD:289699
KU 323..381 CDD:197529
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011
EGF 639..671 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.