DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and R12A1.3

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_503410.3 Gene:R12A1.3 / 178632 WormBaseID:WBGene00020017 Length:271 Species:Caenorhabditis elegans


Alignment Length:51 Identity:21/51 - (41%)
Similarity:26/51 - (50%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.:|...|.|.|...|:.||....:|.:|.:.||.||.|||.|...|..||
 Worm   162 CSLPLAVGSCTAPAVRFYYDASSGRCNQFMYSGCGGNANNFQSLSSCQGTC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 21/51 (41%)
R12A1.3NP_503410.3 Kunitz_BPTI 161..213 CDD:425421 21/51 (41%)

Return to query results.
Submit another query.