powered by:
Protein Alignment CG13748 and appb
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_690842.1 |
Gene: | appb / 170846 |
ZFINID: | ZDB-GENE-020220-1 |
Length: | 694 |
Species: | Danio rerio |
Alignment Length: | 36 |
Identity: | 12/36 - (33%) |
Similarity: | 17/36 - (47%) |
Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 ANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQK 83
|||..:..|.....:|.|....|..||:.|.|.|::
Zfish 565 ANTDNHVEPVDARPIPERGLPTRPEIPKVRLDIEER 600
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
68 |
1.000 |
Domainoid score |
I9689 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2378 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.