DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and appb

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_690842.1 Gene:appb / 170846 ZFINID:ZDB-GENE-020220-1 Length:694 Species:Danio rerio


Alignment Length:36 Identity:12/36 - (33%)
Similarity:17/36 - (47%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQK 83
            |||..:..|.....:|.|....|..||:.|.|.|::
Zfish   565 ANTDNHVEPVDARPIPERGLPTRPEIPKVRLDIEER 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 8/25 (32%)
appbNP_690842.1 A4_EXTRA 29..190 CDD:128326
APP_N 33..133 CDD:280358
APP_Cu_bd 135..190 CDD:289676
APP_E2 306..488 CDD:289677
Beta-APP 599..637 CDD:281491 0/2 (0%)
APP_amyloid 640..690 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9689
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2378
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.