powered by:
Protein Alignment CG13748 and WFDC6
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_543017.1 |
Gene: | WFDC6 / 140870 |
HGNCID: | 16164 |
Length: | 86 |
Species: | Homo sapiens |
Alignment Length: | 34 |
Identity: | 8/34 - (23%) |
Similarity: | 12/34 - (35%) |
Gaps: | 15/34 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 PEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFK 89
||.....|..:| |||::|:
Human 55 PENMKCCPFSRG---------------KKCLDFR 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.