powered by:
Protein Alignment CG13748 and CG43165
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245858.1 |
Gene: | CG43165 / 12798550 |
FlyBaseID: | FBgn0262721 |
Length: | 95 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 27/53 - (50%) |
Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 PARKG----VCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
||..| .|.....::.|.|....|.:|::|||.||:|:|.:.:.|...|:
Fly 29 PAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10083 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X776 |
|
5 | 4.910 |
|
Return to query results.
Submit another query.