DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG43165

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:27/53 - (50%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PARKG----VCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            ||..|    .|.....::.|.|....|.:|::|||.||:|:|.:.:.|...|:
  Fly    29 PAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 16/50 (32%)
CG43165NP_001245858.1 KU 24..81 CDD:294074 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
54.910

Return to query results.
Submit another query.