powered by:
Protein Alignment CG13748 and CG42828
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189271.1 |
Gene: | CG42828 / 10178934 |
FlyBaseID: | FBgn0262010 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 21/70 - (30%) |
Similarity: | 34/70 - (48%) |
Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 AISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
|:.|..|.:..:. :.||.:|...|.|......|.:..::::||.|.|..|.||||.|.:.::
Fly 12 AVLLSTVESAEKR---KAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENRFYTKEN 73
Fly 106 CMSTC 110
|...|
Fly 74 CEKAC 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.