DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG42716

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster


Alignment Length:35 Identity:14/35 - (40%)
Similarity:20/35 - (57%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.|:.:.::|....:.||.||.|.|.|.:||..||
  Fly    58 WYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 14/35 (40%)
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 12/33 (36%)

Return to query results.
Submit another query.