DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG42716

DIOPT Version :9

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster


Alignment Length:35 Identity:14/35 - (40%)
Similarity:20/35 - (57%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.|:.:.::|....:.||.||.|.|.|.:||..||
  Fly    58 WYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 12/33 (36%)
CG42716NP_001189116.1 KU <58..92 CDD:197529 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.