DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and spint1

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_002939591.2 Gene:spint1 / 100488118 XenbaseID:XB-GENE-968962 Length:511 Species:Xenopus tropicalis


Alignment Length:54 Identity:23/54 - (42%)
Similarity:32/54 - (59%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |:.|..|.:.|.||....||.::||...|:||.:|||..|:||:...:||..||
 Frog   237 EEHCFAPHKVGRCRGSFTRWYFNPETNDCLEFTYGGCKPNKNNYLRIEDCRQTC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 23/54 (43%)
spint1XP_002939591.2 MANEC 25..115 CDD:462186
myxo_dep_M36 <125..>230 CDD:468355
Kunitz_HAI1_1-like 235..292 CDD:438666 23/54 (43%)
LDLa 319..353 CDD:238060
Kunitz_HAI1_2-like 374..434 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.