powered by:
Protein Alignment CG13748 and LOC100485348
DIOPT Version :9
Sequence 1: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031750923.1 |
Gene: | LOC100485348 / 100485348 |
-ID: | - |
Length: | 206 |
Species: | Xenopus tropicalis |
Alignment Length: | 60 |
Identity: | 23/60 - (38%) |
Similarity: | 34/60 - (56%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 NTHP--EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
|.:| :..|.:|...|.|.||||:|.|:.|:..|..|.:.||.||.|.|.:.::|.:.|
Frog 81 NIYPPGDAVCDLPMESGPCLALIPQWYYNKERGACHSFLYSGCQGNGNRFENKENCTTLC 140
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13748 | NP_610430.1 |
Kunitz_BPTI |
59..110 |
CDD:278443 |
20/50 (40%) |
LOC100485348 | XP_031750923.1 |
KU |
23..75 |
CDD:412162 |
|
KU |
88..141 |
CDD:238057 |
21/53 (40%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.