DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and LOC100485348

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_031750923.1 Gene:LOC100485348 / 100485348 XenbaseID:XB-GENE-29077767 Length:206 Species:Xenopus tropicalis


Alignment Length:60 Identity:23/60 - (38%)
Similarity:34/60 - (56%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NTHP--EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |.:|  :..|.:|...|.|.||||:|.|:.|:..|..|.:.||.||.|.|.:.::|.:.|
 Frog    81 NIYPPGDAVCDLPMESGPCLALIPQWYYNKERGACHSFLYSGCQGNGNRFENKENCTTLC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 21/54 (39%)
LOC100485348XP_031750923.1 Kunitz-type 23..75 CDD:444694
Kunitz-type 87..140 CDD:444694 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.