| Sequence 1: | NP_610430.1 | Gene: | CG13748 / 35896 | FlyBaseID: | FBgn0033355 | Length: | 113 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031750923.1 | Gene: | LOC100485348 / 100485348 | XenbaseID: | XB-GENE-29077767 | Length: | 206 | Species: | Xenopus tropicalis |
| Alignment Length: | 60 | Identity: | 23/60 - (38%) |
|---|---|---|---|
| Similarity: | 34/60 - (56%) | Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 NTHP--EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13748 | NP_610430.1 | Kunitz-type | 57..112 | CDD:444694 | 21/54 (39%) |
| LOC100485348 | XP_031750923.1 | Kunitz-type | 23..75 | CDD:444694 | |
| Kunitz-type | 87..140 | CDD:444694 | 20/52 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||