DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and REX3

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_013208.1 Gene:REX3 / 850797 SGDID:S000004097 Length:404 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:66/301 - (21%)
Similarity:112/301 - (37%) Gaps:93/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 YHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHV-----EDDSESAST 975
            ||.:|...:.|....|:....:.:       :||.|.   ::.|..|:.||     .|:....|.
Yeast   176 YHPLKRIYNRDTKNHQYPCCGETT-------DSVSFL---RLGCKTFFHHVFRGESYDELCKISK 230

  Fly   976 TSST-VTESEETIPSESSSGSPTNLSNPFLE-EIVSPMLGNLSADATLQPLQSDEMPQSGDLVAM 1038
            .||| ..:..|.:.|.....:.|:|....:. .||....|....|..:||:        ||:|.:
Yeast   231 FSSTDDIDGVENVLSLDCEMAFTSLGYEMIRLTIVDFFTGKTLFDHVIQPI--------GDIVDL 287

  Fly  1039 DAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQF 1103
            :::|..::                    .:.|.:|                 .|.::.:|..   
Yeast   288 NSDFSGVH--------------------EIDRTNC-----------------PTYKEALDVF--- 312

  Fly  1104 SGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLF 1168
                   |..|                  |::...|.:||||:||..|:.::  ..::|||..|:
Yeast   313 -------LSEN------------------LINKNSILIGHGLENDLNVMRLF--HNKVIDTAILY 350

  Fly  1169 HMPHHRMVSLRFLAWHFLGTKIQSETHDSIEDARTTLQLYK 1209
            .....: |||:.||:..|..|||:..|||.:||..|:.:.|
Yeast   351 SRTKFK-VSLKNLAFEVLSRKIQNGEHDSSQDAIATMDVVK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 5/23 (22%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 36/172 (21%)
REX3NP_013208.1 REX1_like 244..390 CDD:99848 47/221 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.