DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and AT3G50090

DIOPT Version :10

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_190578.1 Gene:AT3G50090 / 824171 AraportID:AT3G50090 Length:322 Species:Arabidopsis thaliana


Alignment Length:200 Identity:46/200 - (23%)
Similarity:73/200 - (36%) Gaps:71/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1064 CHMSVARISCIRGQGPAEGV-----------PFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSK 1117
            |.|    :.|..|   .|||           ..:|:::...:.||||.|..:|:...|:     :
plant    80 CEM----VLCEDG---TEGVVRVGAVDRNLKVILDEFVKPHKPVVDYRTAITGVTAEDV-----Q 132

  Fly  1118 KRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV---SLR 1179
            |...:|....:||:..:..|.|.:.|.:               :|||..:|..|:.|.:   ||.
plant   133 KATLSLVDIQEKLRPFLSAGAILIDHPI---------------VIDTSLVFKYPNSRKLRRPSLN 182

  Fly  1180 FLAWHFLGTKIQSE--THDSIEDAR---------------TTLQLYK-------------HYLKL 1214
            .|....||.::|..  :|..:.||.               ||:.|.|             |:|..
plant   183 TLCMSVLGYEVQKAGVSHHCVHDAAAAMKLALAVIKKRVDTTITLTKEAEKSRLFLHRIPHHLSS 247

  Fly  1215 QEEKK 1219
            :|.||
plant   248 EELKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:475233
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:463872
zf-CCCH_2 799..816 CDD:464217
PAN2_exo 1036..1209 CDD:99846 40/175 (23%)
AT3G50090NP_190578.1 DnaQ_like_exo 76..205 CDD:447876 35/151 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.