DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and REXO5

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001185982.1 Gene:REXO5 / 81691 HGNCID:24661 Length:774 Species:Homo sapiens


Alignment Length:272 Identity:79/272 - (29%)
Similarity:117/272 - (43%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   988 PSESSSGSPTNL-SNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENE 1051
            |..|::.:..|| .:|.:::..|..:|......|.:.:::...|..|                  
Human   160 PLPSNAKAAINLQDDPIIQKYGSKKVGLTRCLLTKEEMRTFHFPLQG------------------ 206

  Fly  1052 IRPDGKTATIKPCHMSVARIS---------CIRGQG--------PAE-GVPFMDDYISTQEKVVD 1098
             .||.:...:..|:.|:|..|         |:..:|        .|| |...||:.:..:.|::|
Human   207 -FPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSKGRELTRISLVAEGGCCVMDELVKPENKILD 270

  Fly  1099 YLTQFSGIKPGDLDANFSKKRL----TALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSE 1159
            |||.||||         :||.|    |.||...::||.|:....:.|||.|..|.|.:.:..|  
Human   271 YLTSFSGI---------TKKILNPVTTKLKDVQRQLKALLPPDAVLVGHSLDLDLRALKMIHP-- 324

  Fly  1160 QIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSET---HDSIEDARTTLQLYKHYLKLQEEKKFA 1221
            .:|||..|:.....|...|:|||...||..||...   ||:.|||||.|:|.:::|| ...||.|
Human   325 YVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCPDRLGHDATEDARTILELARYFLK-HGPKKIA 388

  Fly  1222 ----NALKNLYE 1229
                .||.|..|
Human   389 ELNLEALANHQE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 60/197 (30%)
REXO5NP_001185982.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
REX1_like 229..377 CDD:99848 54/158 (34%)
RRM1_NEFsp 506..576 CDD:240719
RRM_SF 602..672 CDD:327398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.